SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013225 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013225
Domain Number 1 Region: 116-245
Classification Level Classification E-value
Superfamily TPR-like 3.8e-30
Family Tetratricopeptide repeat (TPR) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013225   Gene: ENSMPUG00000013323   Transcript: ENSMPUT00000013436
Sequence length 293
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:19806324:19850811:-1 gene:ENSMPUG00000013323 transcript:ENSMPUT00000013436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKSENCGAPEDLFNGLKITDPQEAECATPPVSSPRDHHLQSKLFKDVESHSQEDQGEE
ECFHDLSASFEKEEPGADKVENKPDDNVNSSELDEEYLIELEKNMPDEEKQKRREESTRL
KEEGNAQFKRGDYTEAESSYSQALQMCPSCFQKDRSILFSNRAAARMKQDKKEMAISDCN
KAIQLNPGYIRAILRRAELYEKTDKLDEALEDYKSILEKDPSIHQAREACMRLPKQIEER
NERLKAEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR
Download sequence
Identical sequences M3YPG7
XP_004737760.1.14098 XP_004737761.1.14098 XP_004737764.1.14098 ENSMPUP00000013225 ENSMPUP00000013225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]