SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013244 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013244
Domain Number 1 Region: 1044-1393
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.94e-96
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000315
Further Details:      
 
Domain Number 2 Region: 848-1038
Classification Level Classification E-value
Superfamily ARM repeat 1.61e-54
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000862
Further Details:      
 
Domain Number 3 Region: 354-522
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-44
Family Ras-binding domain, RBD 0.017
Further Details:      
 
Domain Number 4 Region: 680-844
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.42e-36
Family PLC-like (P variant) 0.022
Further Details:      
 
Domain Number 5 Region: 1423-1541
Classification Level Classification E-value
Superfamily PX domain 1.96e-27
Family PX domain 0.0012
Further Details:      
 
Domain Number 6 Region: 1560-1676
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-22
Family Synaptotagmin-like (S variant) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013244   Gene: ENSMPUG00000013343   Transcript: ENSMPUT00000013456
Sequence length 1702
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896930.1:8139806:8249992:-1 gene:ENSMPUG00000013343 transcript:ENSMPUT00000013456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQISSNNGFKQCSSHLEPTRTKEVDKEEALQMEAEALAKLQKDRRVTDHQRGFELSSNT
RQKAQVYNKQDYDLMVFPESDTQKRAVDIDVEKLTQAELEKLLLDDSFETRKTPVLPVTP
VLSPSFSTQVYLRPTIQRGQWPPGLSGPSTYTLPSIYQSTYSSKQTVFQNGFNPRMPAFP
STEPIYLTFPGQSPYFSYPLTPATPFHPQGSLPVYRPVVSPDMAKLFDKIASTSEFLKNG
KARTDLEITDPKATVNTLQVSPKSEDISKFDWLDLDPLSKPKVDNVEVLDHEEEKSIPGL
LAEDPWDAVLLEERSPTSGHLESKVNGKSPSGATVTRSQSLNIRTTQFTKVQGQVSQKDP
NGTSGLSTGSSLVQEIEVQNEEVAAFCQSITKLKTNFPYTNHCTNPGYLLSPVTVQRNIC
GENASVKVSIEIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQE
EVLQNNHCLGSHEYIQNCRKWDTEIKLQLLTFSAMCQNLARTAEDDKTPVDLNKHLHQME
KPYKEVMTRYPVEELLDSYHNQVELALQIENQHRAVDQVIKAVRKICSALDGVETLAITE
AVKKLKRAVNLPRSKSADVTSLSGEGDISKSSSRGSLNSENPVQVSIDQLTAAIYDLLRL
HANCGRSPTNCAQSNRNVKEAWTTTEQLQFTIFAAHGISSNWVSNYEKYYLICSLSHNGK
DLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESLLHLTLFGILNQSSGSSPDS
NKQRKGPEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHTNPVTGTVPRKGYVMERIVLQV
DFPSPMFDVIYTTPQVDRSIIEQHNLETLENDIKGKLLDIIHRDSSLGLSKEDKAFLWEK
RYYCLKHPNSLPKVLASAPNWKWVNLAKTYSLLQQWPPLNPLTALELLDSKFADQEVRSI
AVTWIEAISDDELTDLLPQFVQALKYEIYLNSSLVRFLLSRALGNIHIAHNLYWLLKDAL
HDAQFGARYEHVLGALLSVGGKGLREELLKQTKLVQLLGGVAEKVRQASGSARQVVLQRS
MERVQSFFLRNKCRLPLNPSLVAKELNIKSCSFFSSNAVPLKVTMLNADPMGDEINVMFK
VGEDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPASDTLRKIQV
EYGVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIML
RSTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQ
AYNLIRKQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESS
LGSIATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNP
DKHYIYVVRILREGQLEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKD
VAAKRKIELNSYLQSLMSASTDVAECDLVCTFFHPLLRDEKAEGIARSADAGPFSPTPGQ
IGGAVKLSISYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDTHKTSKRKTKISRKT
RNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETITVR
WRTGCMCWRWRHEWKHKHLGYH
Download sequence
Identical sequences M3YPI6
ENSMPUP00000013244 ENSMPUP00000013244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]