SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013252 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013252
Domain Number 1 Region: 231-276
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000143
Family TRASH domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013252   Gene: ENSMPUG00000013351   Transcript: ENSMPUT00000013464
Sequence length 414
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897167.1:1093070:1155470:-1 gene:ENSMPUG00000013351 transcript:ENSMPUT00000013464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKCSVRGLDLDEQTPVLLEHKAMAASLMDIGNSFGNPASPLVNRCRNSSVEDGDDDDDV
VFIESIQPPSTSTPAIADQRNFIFASSSNERLQGNYSIILPASRDLPSQKGNVSETIVID
DEEDIKTNGGEKKNSSNFVEWGLPGTKNRTRDLDFSTSSLSRKTKTAVGPFNPGRMNVAG
DEFQNGEYATHHSPDSWISQSASFPCNQKPPGVDSLAPVASLPKQIFQSSVQQQLTKPAK
ITCAYCRKPLQKGQTAYQRKGSVHLFCSTTCLSSFSHKRTPKKRNVISKKDVPTKKATTV
PQVESRDSSQEFCSTSLPPYEDNQNLRKRINKSRCIICSKLTEIRHEVSVNNVIHKLCSN
QCFNKYRLANGLIMNCCEQCGEYLPSKSAGNNVLMIEGQQTRFCCQGCINEYKQ
Download sequence
Identical sequences M3YPJ4
ENSMPUP00000013252 ENSMPUP00000013252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]