SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013290 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013290
Domain Number 1 Region: 322-459
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.28e-32
Family Synaptotagmin-like (S variant) 0.00022
Further Details:      
 
Domain Number 2 Region: 182-318
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-31
Family Synaptotagmin-like (S variant) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013290   Gene: ENSMPUG00000013389   Transcript: ENSMPUT00000013502
Sequence length 474
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:1274508:1360817:1 gene:ENSMPUG00000013389 transcript:ENSMPUT00000013502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYIQLEPLNEGFLSRISDLLLCRWTCRHCCQRCYESSCCQSSEDEVEILGPFPAQTPPW
LMASRSSDKDGDSVHTGSEVPLTPRTNSPDRRCSSSDTSKSTYSLTRRISSLESRRPSSP
LIDIKPIEFGVLSAKKEPIQPSVLRRTYTPDDYFRKFEPQLYSLDSNSDDVDFLTDEEIL
SKYQLGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQK
NSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEV
DLVKGGHWWKALVPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPF
VKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSND
FIGRIVIGQYSSGPSESNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT
Download sequence
Identical sequences M3YPN2
ENSMPUP00000013290 ENSMPUP00000013290 XP_004750365.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]