SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013314 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013314
Domain Number 1 Region: 107-190
Classification Level Classification E-value
Superfamily E set domains 3.64e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013314
Domain Number - Region: 197-248
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00135
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013314   Gene: ENSMPUG00000013414   Transcript: ENSMPUT00000013527
Sequence length 436
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:20753381:20953110:1 gene:ENSMPUG00000013414 transcript:ENSMPUT00000013527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPVLVKRWDFYGSIQKDPGGRAGTPLSRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVS
TTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHAATPCIKAISPSEGWTT
GGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFC
KGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYGMPHN
NQEIILKRAADIAEALYSVPRNHSQLPALTNTSVHAGMMGVNSFSGQLAVNVSEASQATN
QGFTRNSSSVSPHGYVPSTTPQQTNYNSVSTSMNGYGTAAMSNLGGSPTFLNGSAANSPY
AIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTST
NGNSLQVISSFLFSPL
Download sequence
Identical sequences M3YPQ6
ENSMPUP00000013314 ENSMPUP00000013314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]