SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013315 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013315
Domain Number 1 Region: 40-137
Classification Level Classification E-value
Superfamily SH2 domain 7.61e-29
Family SH2 domain 0.00000411
Further Details:      
 
Domain Number 2 Region: 248-314
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-22
Family SH3-domain 0.0000377
Further Details:      
 
Domain Number 3 Region: 3-54
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000024
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013315   Gene: ENSMPUG00000013415   Transcript: ENSMPUT00000013528
Sequence length 316
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:13842204:13906775:1 gene:ENSMPUG00000013415 transcript:ENSMPUT00000013528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIAKFDFTASGEDELSFHTGDVLKILSNQQEWFKAELGSQEGYVPKNFIDIQFPEWFH
EGLSRHQAENLLMGKEIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTTSISKQKQIFLRDRTREDQGHRGNSLDRRPQGGPHLSGAVGEEMRP
SMIRKLSDHPAPPPSQYSPAPPAQQHRYLQHPHFHQDRRGGSLDINDGHCGMGAGSEMNT
ALMHRRHTDPVQLQVAGRVRWARALYDFEALEDDELGFRCGEVVEVLDSSNPSWWTGRLH
NKLGLFPANYVAPMIR
Download sequence
Identical sequences M3YPQ7
ENSMPUP00000013315 XP_004743359.1.14098 XP_004743360.1.14098 XP_004743361.1.14098 XP_012907097.1.14098 XP_012907098.1.14098 ENSMPUP00000013315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]