SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013323 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013323
Domain Number 1 Region: 522-885
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.1e-125
Family Oxysterol-binding protein 0.0011
Further Details:      
 
Domain Number 2 Region: 16-144
Classification Level Classification E-value
Superfamily PH domain-like 2.25e-19
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013323   Gene: ENSMPUG00000013423   Transcript: ENSMPUT00000013536
Sequence length 887
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:14198988:14372573:1 gene:ENSMPUG00000013423 transcript:ENSMPUT00000013536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMSYTQEPAIQKGFLLK
KRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTE
EHIYHLKVKSEEIFDEWVSKLRHHRMYRQNEIAMFPHEVNHYFPGSTVTDSASGVLDSIS
SRKRSSISKQNSIQTGSNLSFSCAGETRVPLWLQSSEDMEKCSKDLAHCHTYLVEMSQLL
QSMDVLHRTYSAPAINAIQGTAFESPKKEKRSHRRWRSRAIGKDTTGTLQVPKPFSGPVR
LHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNTLSAEREK
MKLLMEQDVSSPPSAQVIGLKHALSSALAQNTDLKERLRRIHAESLLLDSPAAAKSGDSL
AEENSRDDSRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISEDDSYVSDISD
NLSLDNLSNDLDNERQTLGPVLESGGEAKSKRRTCLPAPCPSASAVSLWNILRNNIGKDL
SKVAMPVELNEPLNTLQRLCEELEYSELLDKAAQIPNALERMVYVAAFAVSAYASSYFRA
GSKPFNPVLGETYECIREDKGFQFFSEQVSHHPPISACHAESGNFVFWQDVRWKNKFWGK
SMEIVPIGTTHVTLPAFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNLNDDSCHCKV
NFIKAKYWSTNAREIEGTVFDKDGKVVHRLFGKWHESIYCGGSSSSTCVWRANPMPKGYE
QYYGFTQFALELNEMDPLSKSLLPPTDTRFRPDQRFLEEGNIEEAEIQKQRIEQLQRERR
RVLEENCVEHQPRFFRKSSDDSWVSNGTYLELRKDLGFSKLDHPVLW
Download sequence
Identical sequences M3YPR5
XP_004743363.1.14098 XP_004743364.1.14098 XP_004743365.1.14098 ENSMPUP00000013323 ENSMPUP00000013323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]