SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013347 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013347
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily ENTH/VHS domain 3.74e-53
Family ENTH domain 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013347   Gene: ENSMPUG00000013448   Transcript: ENSMPUT00000013561
Sequence length 625
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:21680411:21741189:1 gene:ENSMPUG00000013448 transcript:ENSMPUT00000013561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNMWKVRELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPEL
MNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEH
GKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFRYSERYDPEP
KSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKA
RRGRSPKGEFKDEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASP
DQNASAHTPQSSLKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGSTAASGSFP
SQVTATSGNGDFGDWSAFNQAPSGPGASSGELFGSASQPAVELVSGSQPALGPPPAASNS
SDLFDLMGSSQATMTSSQSMNFSMMSTNTVGLGLPMSRSQNTDMVQKPVSKTLPSTWSDP
SVNISLDNLLPGMQPSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNIIPVRPQ
TNPLMGGPMPMSMPSVMTGTMGIAPLGNTPMMNQSMMGMNMNMGMSAAGMGLTGTMGMGM
PNLAMTSGTVQPKQDAFANFANFSK
Download sequence
Identical sequences M3YPT9
ENSMPUP00000013347 XP_004737777.1.14098 ENSMPUP00000013347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]