SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013361 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013361
Domain Number 1 Region: 6-233
Classification Level Classification E-value
Superfamily SET domain 5.23e-31
Family Viral histone H3 Lysine 27 Methyltransferase 0.064
Further Details:      
 
Domain Number 2 Region: 316-388
Classification Level Classification E-value
Superfamily TPR-like 0.0000158
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013361   Gene: ENSMPUG00000013463   Transcript: ENSMPUT00000013576
Sequence length 405
Comment pep:novel scaffold:MusPutFur1.0:GL897187.1:1433369:1467093:1 gene:ENSMPUG00000013463 transcript:ENSMPUT00000013576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLTYTVPSSAFLAFLINRGCHSHCIFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLE
CSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLEKLDNEKRDLI
QSDVAALHHFYSKHLEFPDTDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSC
CPNVIVTYKGTLAEVRAVQEISPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCQCQECTT
KDKDKAKVEIRKLSDPPKAETIREMVRYARNVIEEFRRAKHYKAPPSELLEICELSQEKM
GSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALRYGQKIIKPYSKHYPLYSLNVASMWLKL
GRLYMGLEDKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Download sequence
Identical sequences M3YPV3
ENSMPUP00000013361 ENSMPUP00000013361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]