SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013395 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013395
Domain Number 1 Region: 156-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000252
Family LIM domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013395
Domain Number - Region: 214-246
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000621
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013395   Gene: ENSMPUG00000013497   Transcript: ENSMPUT00000013610
Sequence length 386
Comment pep:novel scaffold:MusPutFur1.0:GL896902.1:6452743:6458256:-1 gene:ENSMPUG00000013497 transcript:ENSMPUT00000013610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLNSDWPHQGESLSPQEPGPPANSDSDLRHLLEKYSEGTSAQSPEVLSLGLPGLDTQG
APNWPELRILLQQLPPQDSDERYCLALGEDEVAELRLFCNQRRQEALGQGVACRVSPKLA
EHTCEKCRERLRPGEYGVFAAPAGERRGWHPACFACQACGQALINLIYFYHDGHLYCGRH
HAELLRPRCPACDQLIFSQRCTEAEGRRWHENHFCCQDCAGPLGGGRYALPGGGPCCPSC
FESRYSDAGWSQALAREGRPLLGEARLGRVEEGDCAPLDIATISRAALPAAASHSSPGTQ
RGLLRSSPEQEGRAGDQAEAPKGRERGRLETPLDAKQDAPCPTCSSSSDSEPEGFFLGQR
LPGPWKTPGSLQAGDSDNSRKHCTIC
Download sequence
Identical sequences M3YPY7
XP_004739984.2.14098 XP_004739985.1.14098 XP_004739987.1.14098 XP_004739988.1.14098 ENSMPUP00000013395 ENSMPUP00000013395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]