SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013402 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013402
Domain Number 1 Region: 786-1083
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000899
Further Details:      
 
Domain Number 2 Region: 114-257
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-32
Family Third domain of FERM 0.0051
Further Details:      
 
Domain Number 3 Region: 6-113
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-29
Family Second domain of FERM 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013402   Gene: ENSMPUG00000013504   Transcript: ENSMPUT00000013617
Sequence length 1088
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897187.1:1474974:1563012:-1 gene:ENSMPUG00000013504 transcript:ENSMPUT00000013617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYVPNVSWLQQEATRYQYYLQVKKDVLEGRLRCTLEQVIRLAGLAVQADFGDYNQFDSQ
DFLREYVLFPMDLALEEAVLEELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEI
FSVKDNHGNSVHLGIFFMGIFVRNRIGRQAVIYRWNDIGNITHNKSTILVELINKEETAL
FHTDDIENAKYISRLFATRHKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPP
MHVQCGEHYSETHTSQDSIVHGNEEALYRNSHNSLDLNYLNGTVTNGSVCSAHSINSLSC
SQTFVQASPVSSNLSIPGSDIMRADYIPSHRHSAIIVPSYRPTPDYETVMRQLKRGVLPT
DSQSQSLRNLNIINTHAYNQPEDLVYSQPEMRERHPYTVPYGPQGGYGNKLVGPCDPMNP
KNCTVPSKPGASAISHTVSTPELANTQLQGAQSYSAAHMLKNYLFRPPPPYPRPRPATST
PDLASHRHKYVSGSSPDLVTRKVQLSVKTFQEDSSPVVHQSLQEVSEPLTAKHHGPVNKR
HSLEVMSSMVRGMEAMTLKSLNIPMARRNTLREQGPPEEVPGSHEAHQLPHYHHKKTFSD
ATMLIHSSESEDEEDEEVPGSVPQIPVLREKMGYSAQLQAALARIPNKPPPEYPGPRKSV
SNGALRQDQVGLPPAVARARVLRHGPAKAISVSRADQLAVAGPSLGPSISEPDLTSVKER
VKKEPVKERPVSEMFSLEDSIIEREMALRNLEKQKMATLEAQKRPLMLAALNGLSVARVS
GREDSRADATRVPMDERFRTLKKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRI
REVVPYEENRVELVPTKENNTGYINASHIKVVVGGAQWHYIATQGPLPHTCHDFWQMVWE
QGANVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVK
HLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGPRSLHPPIVV
HCSAGVGRTGVVILSELMIYCLEHNEKVDVPVMLRLLREQRMFMIQTIAQYKFVYQVLVQ
FLQNSRLI
Download sequence
Identical sequences M3YPZ4
ENSMPUP00000013402 ENSMPUP00000013402 XP_012904672.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]