SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013409 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013409
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-27
Family Ankyrin repeat 0.00096
Further Details:      
 
Domain Number 2 Region: 338-398
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000143
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013409   Gene: ENSMPUG00000013511   Transcript: ENSMPUT00000013624
Sequence length 412
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897235.1:534599:545097:-1 gene:ENSMPUG00000013511 transcript:ENSMPUT00000013624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRYHQAASDSYLELLKEATKRDLNLSDEDGMTPTLLAAYHGNLEALEIICSRGGDPNR
CDIWGNTPLHVAASNGHTHCVSFLVNFGANIFALDNNFQSPLDAAASREQNECVALLDKA
ATAQNIMNPKKVIRLKEQAQKNARRQIKECEKLQEKHESKMARNYNKEESGTLSSSMSSL
SKASAPGTFGSLSKGIKDTFKIKFKKNKDTAEQVGKERRSEQRNVMEVFREEEEDRFSGD
FQDRLQFSEEEGSCVQHESILNRPGLGNIVFRRNKLSSAEDISDSKRELGFKMSSELLQR
QGAAEADEAEAGREEEDNIHEDDLPWDEDEVEWEEDVVDATPLEVFLQSHHLEEFLPIFM
REQIDLEALLLCTDDDLQSIQMQLGPRKKVLNAINRRKQVLQQPGQLVDTSL
Download sequence
Identical sequences M3YQ01
XP_004780192.1.14098 ENSMPUP00000013409 ENSMPUP00000013409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]