SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013446 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013446
Domain Number 1 Region: 80-403
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-85
Family Protein kinases, catalytic subunit 0.00000271
Further Details:      
 
Domain Number 2 Region: 968-1036
Classification Level Classification E-value
Superfamily G protein-binding domain 4.45e-26
Family RhoA-binding domain 0.0000389
Further Details:      
 
Domain Number 3 Region: 1140-1230,1307-1341
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000278
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 4 Region: 1249-1298
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000419
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013446
Domain Number - Region: 428-535
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0011
Family Myosin rod fragments 0.0027
Further Details:      
 
Domain Number - Region: 544-648
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.011
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013446   Gene: ENSMPUG00000013549   Transcript: ENSMPUT00000013662
Sequence length 1389
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896914.1:7546157:7679801:-1 gene:ENSMPUG00000013549 transcript:ENSMPUT00000013662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAPEAVPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNID
NFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMI
KRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDKYLYMVMEYMPGGDLVNLMSNYDVPEK
WAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDT
AVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLVGTYSKIMDH
KNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWNWDNIRETAA
PVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENLLLSDSSPCR
ENDSVQSRKNEESQEIQKKLYTLEEHLSTEMQAKEELEQKCKSVNTRLEKVAKELEEEIT
LRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQLEDLKKRNQN
SQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNCLL
ETAKLKLEKEFMNLQSVLESERRDRTHGSEIINDLQGRISGLEEDLKNGKTLLAKAEMEK
RQLQEKLTDLEKEKNNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAK
SEAMKEMEKKLSEERTLKQKVENLLLEAEKRCSIFDCDLKQSQQKINELLKQKDVLNEDV
RNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMSLEKQNAELR
KERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLCKELQQKKQDLQEERD
SLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIA
SLEETNRTLTSDVANLANEKEELNNKLKDAQEQLSRLKDEEISAAAIKAQFEKQLLTERT
LKTQAVNKLAEIMNRKEPVKRGSDTDVRRKEKENRKLHMELKSEREKLTQQMIKYQKELN
EMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPGDAEADDGFP
ESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVR
PVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKGHEFIPTLYH
FPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLL
LANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPSS
GPALRIILH
Download sequence
Identical sequences M3YQ38
ENSMPUP00000013446 XP_012908376.1.14098 ENSMPUP00000013446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]