SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013494 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013494
Domain Number 1 Region: 214-375,476-729
Classification Level Classification E-value
Superfamily Ras GEF 4.71e-106
Family Ras GEF 0.00016
Further Details:      
 
Domain Number 2 Region: 383-485
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-32
Family Ras-binding domain, RBD 0.0000092
Further Details:      
 
Domain Number 3 Region: 2-68
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000871
Family DEP domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013494   Gene: ENSMPUG00000013597   Transcript: ENSMPUT00000013710
Sequence length 730
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:16500666:16673306:1 gene:ENSMPUG00000013597 transcript:ENSMPUT00000013710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIGVWQLLLDMGIMLSVDQNLYFQDTYVFYQFSSDECSYLYCEFEREEEWQNGVKLLLQ
LVPLIPARAGICELSHQKIEDSEESSDEILVRLTSAVQRELAAVIALKARKSAIEQEEEN
GDKHVIGTEARGVPDSQAGVMCKLQERDDIGRIELVQKLARENCQFLQTDKKEQEKSEHD
DEVATVEVKEQERNVLVLKRVQSCSPAPPAGGAERDWRYVVVSGTPEKILEHLLNDLHLE
EVQDKETETLLDDFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDVPCRKRKVLHLV
SQWIALYKDWLHEDEHSKMFLKTIYRNVLDDVYEYPILEKELKEFQKILGMHRRHTVDEY
SPQRKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYITEHSYVSVKAKVSSTAQEILKV
VAEKIQHAEEELALVAVTFSGEKHELQPNDLASSKSLEASGRIYVYRKDLADTLNPFAEN
EESQQRSMRILGMNTWDLALELMNFDWSLFNSIHEQELIYFTFGRQGSGEHTANLSLLLQ
RCNEVQLWVATEVLLCSQLAKRVQLLKKFIKIAAHCKAQRNLNSFFAIVMGLNTASVSRL
SQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMKPPKIPFMPLLLKDVTFIHEGN
KTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGGDMSPKEHQELKSYVNHLYVIDSQQALF
ELSHRIEPRV
Download sequence
Identical sequences M3YQ85
ENSMPUP00000013494 ENSMPUP00000013494 XP_012907126.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]