SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013516 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013516
Domain Number 1 Region: 1740-1780,1818-2013
Classification Level Classification E-value
Superfamily Plakin repeat 8.63e-66
Family Plakin repeat 0.0000105
Further Details:      
 
Domain Number 2 Region: 1650-1768
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000575
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 283-409
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000115
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 4 Region: 699-824,852-879
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000767
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 5 Region: 155-225
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000461
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 6 Region: 585-697
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000599
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013516   Gene: ENSMPUG00000013619   Transcript: ENSMPUT00000013732
Sequence length 2033
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:5189172:5207637:1 gene:ENSMPUG00000013619 transcript:ENSMPUT00000013732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKGLSKGSQGKGSPKGSPGKGSPKGSPSKHSRAATQELALLISRMQANADQVERDILET
QKRLQQDRLHSEQSQALQHRQEVGRSLKEAEVLLKDLFLDVDKARRLKHPQAEEIEKDIK
QLHERVTQECAEYRALYEKIVLPPDVGPRVDWARVLEQKQKQVCEGRYGPGMAELEQQIA
EHNILQKEIEAYGQQLRNLIGPDAATIRSQYRDLLKAASWRGQSLGSLYTHLQACTRQLS
ALAQQQQSILQQDWSDLLVDPEGLRREYEHFKQHELLSQEQSVNQLEDDGERMVELGHPA
VGPIQTHQEALKMEWQNFLNLCICQESQLQHVEAYRRFQEEADSVSQTLEKVNSSLDTQY
SPAPGAPPGAPTELLQQGEAEKKQLAVAEKTIKDLQRRSQQVAPLPQRRNPPQQPLHVDS
ICDWDSGEVQLLRGERYLLMDNTDQHTWVVQGPGGETKRAPAACFCIPAPDPEAVTRASK
LASELQALKQRLDTVQSHLVASATQPLQTGQQAPTGSAPADPQAQKLLTQMTRLDGDLKQ
IEKQVLAWARAPLSRETPLQDLEGRIQSHKDTAQRLQGLGAEKEAAQQECEAFLSAQPVG
PSALNLPVTLNSVKNKYNDVQVLCNLYGEKARAALGLERQIQDADRVIRGFETTVAQEAP
IPASPGALQDRVSELQRLRRELLERQACVLGLHRELKATEHACGALRNNFHEFCQDLPRQ
QRQARALTDRYHAVGDQLDLREKMLQDVGLTYQQFKNCRDNLSFWLEHLPRAQVRPGEGP
SQIAYKLQAQKRLQQEIQGREQDRAMVSRLSQDLQAALQDYELQADTYRCSLETTEAGSA
PKRARVVPLQESIRAQEKSLTKAYTELAAAHQQQLRQLEFARKMLEKKELSEDIQVTHGA
QQGSAGPARAGRESEALKSQLEEERKRVAQVQQQLQEQRDQLLQLRTQRPVERLEEKEVV
EFYRDPQLESSLSRARSQLEDEGKKRASLQADLEAAAQKVVQLESKRRAMQPHLLTKEVT
QIERDPGLESQAAQLSGEIQHLRGENAAVSARLEALKKELLALEQKAPSVKEKVVVKEVV
KVEKDLEMLKAAQALRRQVEEDAGRRKAAADAAAQLQARIREQERAIGAVEPKVIVKEVK
TVEQDPGLLEEASRLRGLLEEARSRDAALARELEDLRAKCSALEKQKPKVQLQERVHETF
QVAPETQQEMARLRAQLQETAGRRSRAEQEVEGLLPDLAALRARKPTVEYKEVTREVVKH
ERSPEVLREIDRLKAQLNELVNGSGRAREQLIRLQGERDEWRRERSKVETKTVNKEVVRH
EKDPVLEKEAERLRQEVREAAQKRRAAEDAVHELQNRYLLLERRRPEEKVVVQEVVVTQK
DPKLREDHSRLSRSLDEEAGRRRQLEREVQQLRAAVQEQESLLSFREDRSKKLAAERELR
QLTLRIQELEKRPPVVQEKIIMEEVVKLEKDPALEKSTEALRQDLDQEKTQVTELHRECK
NLQVQIDVLQTTKSQEKTIYKEVIRVEKDRVLEGERSRAWEALNRERAARQSREEDVRHL
RERLDRAEALGRTWAREEAELHKARDQADQERRQLRQELRELERQKQQKVLQLQEEAELL
NQKTESERQKAAQRGQELSQLEAAILCEKDQIYEKERTLRDLHAKVSREELHQETQTRET
NLSTKISILEPDTGKDMSPYEAYKRGVIDRGQYLQLQELECDWEEVTTSGPCGEESVLLD
RKSGKQYSIEAALRCRRISKEEYHLYKDGHLPISEFALLVAGETKPSSSLSIGSIISKSP
LASPAPQSPGFFSPSVNLGLADDSFPIAGIYDTTTDNKCTIKTAVAKNMLDPITGQKLLE
AQAATGGIVDLLSRERYSVHKAMERGLIENSSTQRLLNAQKAFTGIEDPVTKKRLSVGEA
IQKGWMPQESVLPHLQAQHLTGGLIDPKRTGRIPVPQAVLSGMISEELAQLLREEASYEK
DLTDPISKERISYKEAMGRCRRDPLSGLLLLPATLEGYHCYRPASPRLLRCRR
Download sequence
Identical sequences M3YQA7
ENSMPUP00000013516 ENSMPUP00000013516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]