SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013596 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013596
Domain Number 1 Region: 45-81
Classification Level Classification E-value
Superfamily WW domain 0.0000000204
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013596   Gene: ENSMPUG00000013699   Transcript: ENSMPUT00000013813
Sequence length 258
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896945.1:10642871:10646803:1 gene:ENSMPUG00000013699 transcript:ENSMPUT00000013813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSC
GLPYYWNVDTDLVSWLSPHDPNSVVTKSAKKLRASNADAEEKVDRGHEKSDRGHEKSDRG
HEKSDRGHEKSDRERERGYDKVDRERERDRDRDRDRGYDKSEREESKERRHHRREELAPY
PKSKKAASRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPS
PGAVLRANAEASRTKQQD
Download sequence
Identical sequences M3YQI7
XP_004755102.1.14098 XP_004755103.1.14098 XP_004755104.1.14098 ENSMPUP00000013596 ENSMPUP00000013596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]