SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013625 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013625
Domain Number 1 Region: 231-366
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.99e-40
Family Synaptotagmin-like (S variant) 0.00000278
Further Details:      
 
Domain Number 2 Region: 83-215
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.4e-36
Family Synaptotagmin-like (S variant) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013625   Gene: ENSMPUG00000013728   Transcript: ENSMPUT00000013842
Sequence length 376
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:1770419:1804251:-1 gene:ENSMPUG00000013728 transcript:ENSMPUT00000013842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGVRAPVPARVSAAPLAPLRSAPARAARTLTLLGPSDCARDDDEDVDQLFGAYGASPGL
SPGPSPARPPAKPPEDEPDADGYESDDCTALGTLDFSLLYDQENNALHCTISKAKGLKPM
DHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISV
CDEDKFRHNEFIGETRVPLKKLKANHTKTFSICLEKQLPVDKTEDKSLEERGRILISLKY
SSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLKPDVDKKSKHKTAVKKKTLNPEFNEE
FCYEIKHGDLAKKTLEVTVWDYDIGKSNDFIGGVVLGINAKGERLKHWFDCLKNKDKRIE
RWHTLTNELPGAVLSD
Download sequence
Identical sequences M3YQL6
ENSMPUP00000013625 ENSMPUP00000013625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]