SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013666 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013666
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily UBC-like 9.85e-43
Family UEV domain 0.000000145
Further Details:      
 
Domain Number 2 Region: 324-384
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.79e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013666
Domain Number - Region: 237-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00518
Family FCH domain 0.054
Further Details:      
 
Domain Number - Region: 151-211
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0112
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013666   Gene: ENSMPUG00000013769   Transcript: ENSMPUT00000013883
Sequence length 391
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896930.1:9315832:9361265:-1 gene:ENSMPUG00000013769 transcript:ENSMPUT00000013883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYKGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPTISASYPPYQATGPPNTSYIPGMPSGISAYPSGYP
PNPSGYPGCPFPPGGQYPATTSSQYPSQPPVATVGPSRDGTISEDTIRASLISAVSDKLR
WRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLRKKDEELS
SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVF
LKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences G1MHQ6 M3YQQ7
ENSMPUP00000013666 ENSAMEP00000018891 ENSMPUP00000013666 XP_002926202.1.58354 XP_004415716.1.74151 XP_004752157.1.14098 XP_006746794.1.47382 XP_021541511.1.83697 ENSAMEP00000018891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]