SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013680 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013680
Domain Number 1 Region: 111-420,527-564
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.69e-66
Family FAD-linked reductases, N-terminal domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 401-513
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.54e-33
Family L-aminoacid/polyamine oxidase 0.0000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013680   Gene: ENSMPUG00000013783   Transcript: ENSMPUT00000013897
Sequence length 584
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:6268188:6277822:1 gene:ENSMPUG00000013783 transcript:ENSMPUT00000013897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGMGLSHPGLFTMRAGLLCLAQPWGQAGGTWPATPGVELALHKERESCPRLSRSCTAM
TKMRGILILGLLMATSSCLGFLEDLFTCFQDPEYESILVTAQKGLHASPLPKRVVIVGAG
MSGLVAAKALQDAGHQVTILETSNRIGGRVSTIRNKEEGWYHELGPMRIPESHRLIHTYI
KKLGLKLNKFIQYDGNTWYLINGRRHRSKEVQDHPEILGYSLSPTEEGKSPTKLFHQSIA
KVKENFENFNCSQLLSFYDSYSTKAYLVKEGELSEGAVKMIGTVMNEDSGYYKSLLESLR
SSVIFSQSNNFSEITGGFDQLPKALSATLKTGTIRLGSSVETVVRDGSKVRVSYRVGKPG
SVLNHLTADFVILTASAKATRLITFKPPLSQDKREALRLVHYTSATKVILTCEEPFWERD
GIRGGYSVTDRPSRYIYYPSHSFPNGKSILLASYTVDDDSLFFTSLTHEQIVDVILEDLA
AVHQIPKDELRRICPSSAAKRWSLDPLTLGAFAEFTPYQFIDYSQELFKPEGRIHFAGEH
TCTPHGWIDTAIKSGLRAARNIQAAVDKEATGEQKTFPNTQNQV
Download sequence
Identical sequences M3YQS1
ENSMPUP00000013680 ENSMPUP00000013680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]