SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013692 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013692
Domain Number 1 Region: 909-1027
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-22
Family Synaptotagmin-like (S variant) 0.0064
Further Details:      
 
Domain Number 2 Region: 100-212,240-269
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.51e-21
Family Synaptotagmin-like (S variant) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013692   Gene: ENSMPUG00000013795   Transcript: ENSMPUT00000013909
Sequence length 1091
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:5330549:5342735:1 gene:ENSMPUG00000013795 transcript:ENSMPUT00000013909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLLSHLQRRPPLVRQAIKIRRRRVRDLQDPPAHGAQEIEPASHHLSPEERALLYEEAL
YTVLHRLGQPEPGHVRETSELLLYLREAFHVEPEEHQEMLQRVQKLEKPIFCLKATVKQA
KGILGKDVSGFSDPYCLLGIEQGVSVQGGSPGSRRRQKAVVRHTIPEEHTHRTQVIEQTL
NPVWEETFILEFEDINSSSFHLDMWDMDAVESVRQKLGELTDLHGLRRIFKEARKDKGQD
DFLGNIVVRLQDLRCREDHWYPLEPCTETYPDRGQCHLQFQFIHKRRAPAASRSQPSYTV
HLHLLQQLVSHEVTRHQAGSTSWDGSLSPQAATILFLHATQKDLSDFHQSMAQWLAYSRL
YQSLEFPSSCLLHPITSIEYQWIQGRLKGEQLEELAASFSSLLAYGLSLIRKFRSVFPLS
MADSPARLQSLLRVLVQMCKMKAFGELCPDSAPLPRLVTETLRTGTTEWFHLKQQHHQPM
VQGLLEAGKALLSLVQDVIGDLLQCRHTWNKIFQNTLKVDLFSMAFVELQWLVAKRVQDH
TAAVAGSPVSPEMGESLFQLYVSLKELYQLRPGPTDRDGVLALEGFHRWFQPAVPSWLQK
TYSVALARVQRAVQMDELVPLGELTKHSTSAVDLSTCFAQISHTARQLDWPDPEEAFMIT
VKFVEDTCRLALVYCSLIKARARELSAGQKDQGQAANMLCVVVNDMEQLRLVIGKLPAQL
AWEALEQRVGAVLEQDQLQNTLHAQLQGALAGLGHEIRTGVRTLAQQLEVGIATHIRKLV
GVKESVLPEDAILPLMKFLEVKLCYMNTNLVQENFSSLLTLLWTHTLKVLTDAAASQRSC
PLASSRLKIALQNLEICFYAEGCGLPPAALHTDDFQALQRDLELQAASSRELIRKYFCSR
IQRQAETTSEELGAVTVKASYRASEQKLRVELLSASSLLPLDSNGSSDPFVQLTLEPRHE
FPELAPRETQKHKKDLHPLFDETFEFLVPAEPCLKDGACLLLTVLDHDTLGADDLEGEAF
LPLRSVPGLTGTEEPGEVPQTRLPLTYPALNGDPVLQLLESRKGDREAQVFVRLRRQRAK
QASQHAPRPGQ
Download sequence
Identical sequences M3YQT3
ENSMPUP00000013692 ENSMPUP00000013692 XP_004748945.1.14098 XP_004748946.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]