SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013711 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013711
Domain Number 1 Region: 309-372
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000953
Family LIM domain 0.059
Further Details:      
 
Domain Number 2 Region: 369-435
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000441
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013711
Domain Number - Region: 273-312
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0483
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013711   Gene: ENSMPUG00000013814   Transcript: ENSMPUT00000013928
Sequence length 706
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896945.1:10877313:10890091:-1 gene:ENSMPUG00000013814 transcript:ENSMPUT00000013928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEAWLGSRARRLGSSPIWRSWAACPSPLGRGRLGPGVSTGPGADRAGRAPPTPVSDLR
NRAPRPDARWPDGREDSIGLTLPGLTLPGRAMFARGSRRRRSGRAPPEAEDPDRGQPCNS
CREQCPGFLLHGWRKICQHCKCPREEHAVHTVPVDLERIMCRLISDFQRHSISDDDSGCA
SEEYAWVPPGLKPEQVYQFFSCLPEDKVPYVNSPGEKYRIKQLLHQLPPHDSEAQYCTAL
EEEEKKELRAFSQQRKRENLGRGTVRIFPVTITGAICEECGKQIGGGDIAVFASRAGLGA
CWHPQCFVCSTCRELLVDLIYFYHAGKVYCGRHHAERLRPRCQACDEIIFSPECTEAEGR
HWHMGHFCCFECEASLGGQRYVMRQSRPHCCACYEARHAEYCDGCGEHIGLDQGQMAYEG
QHWHASDRCFCCSRCGRALLGRPFLPRRGLIFCSRACSLGSEPTPSGTGRRSWSAGTVST
PLAASTAAFSTAEASETMSKGTSTEPEPVADPEEPTHFLRGAPHRHSMPELGLRSPPEPP
PGLPSQPDPSPEDGAFGRQSTPRVSFRDPLVSEGGPRRTLSAPPAQRRRPRSPPPRGPTH
RQRRRHHHHHHHHGRHSGRHHHHQCDLGSGSDSGSCSSSPSSPSSESSEEDGFFLGERIP
LPPHLCRPGPAKDNATGTPKSPSPQLPRSSRPGMPRQARDKNCIVA
Download sequence
Identical sequences M3YQV2
ENSMPUP00000013711 ENSMPUP00000013711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]