SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013721 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013721
Domain Number 1 Region: 56-183
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000528
Family Pleckstrin-homology domain (PH domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013721   Gene: ENSMPUG00000013824   Transcript: ENSMPUT00000013938
Sequence length 733
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:6940250:6999963:1 gene:ENSMPUG00000013824 transcript:ENSMPUT00000013938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAHAERTGKILTEFLRFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIIFS
GNLFQYQEDNKKWRNRFSLVPHNYGLVLYENKVAYERQVPPRAIINSAGYKILTSLDQYL
ELVGNSLPGTSSKSGTAPILKCPTQFPLILWHPSARHYYFCMMTEAEQDKWQAVLQDCIR
HCNNGIPENSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAE
LAPRLKGKPQERQRQWIQISDAVYRMVYEQAKARFEAVLAKLQLARPAMEATIRTDMDQI
ITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTEVRDVFFKEVTDM
NLNVINEGGADKLGEYMEKLSQLAYHPLKMQSCYEKMEPLRLDGLQQRFDVSSTAVFKQR
AQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRILERVLKKYDYDSSSVRKRFF
REALLQITIPFLLKKLAPTCKSELPRFQELIFEDFARFILVENTYEEVVLQTVMKDILQA
VKEAAVQRKHNLYRDSMVMHNSDPNLHLLAEGAPIDWGEEYGGSMGDSGSPSVPEAATHS
EKRRRAKQVVSVVQDEEAELPFEAGSEPLSPASPDSVTELRGLLAQDLRAESPPPAGPLL
NGALSQESPQPTAASEASSPPASPLRQPPPGKAADLEPPKPSDQETGEQVSSPDGCPPIH
TTTEDSAGVQTEF
Download sequence
Identical sequences M3YQW2
ENSMPUP00000013721 ENSMPUP00000013721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]