SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013724 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013724
Domain Number 1 Region: 33-192
Classification Level Classification E-value
Superfamily L domain-like 8.16e-31
Family Leucine rich effector protein YopM 0.07
Further Details:      
 
Domain Number 2 Region: 572-630
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000898
Family SAM (sterile alpha motif) domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013724
Domain Number - Region: 673-720
Classification Level Classification E-value
Superfamily RING/U-box 0.000247
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013724   Gene: ENSMPUG00000013827   Transcript: ENSMPUT00000013941
Sequence length 727
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:7001137:7040787:-1 gene:ENSMPUG00000013827 transcript:ENSMPUT00000013941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPYGAFATCKVLQKKVL
IVHTNHLTSLLPKSCSLLSLITIKVLDLHDNQLSALPDDIGQLTALQVLNMERNQLTYIP
RSIGNLIQLQTLNVKDNKLKELPDTVGELRSLRTLDISENDIQKLPQLLAHVRTLETLSL
DTSSMVYPPQEVCSAGTQAIQQFLCKESGLEYYPPSQYLLPVLEQDGGDTPRDSADGPSD
RLCREEVEWQNRFSDYEKRKEQKMLEKLEFERRLELGQREHAQLLQQSNNQKDEILQTVK
EEQFRLEQGLSARQRYLDAERQRLQEQLKQTEQNISSRIQKLLQENQRQKKSSEILKSLE
NERIRMEQLMSITQEETENLRRREIASAMQQMLTESCKSRLVQMAYESQRQSLVQQACSS
MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRNQIKLIET
ELLQLTQLEVKRKSLDTEALQEVIAEQRWALSSLLQQLLKEKTRREEELREILTELEAKS
ETKQENYWLIQYQRLLNQKPLSLKLQEEGLERQLAALLVDLSAEHYLPLFAHHRISLDTL
SRMSPADLAKVGVSEAGLQHEILRRVRELLAAARIRPELPNPPKGEALGALEVPTAPEEL
PEPTTPSAPPVELEMPTSECVVCLEREAQMIFLNCGHVCCCHQCCQPLRTCPLCRQEIAQ
CLRLYHS
Download sequence
Identical sequences M3YQW5
ENSMPUP00000013724 ENSMPUP00000013724 XP_004757323.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]