SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013731 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013731
Domain Number 1 Region: 209-352
Classification Level Classification E-value
Superfamily TPR-like 0.0000664
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013731
Domain Number - Region: 132-233
Classification Level Classification E-value
Superfamily TPR-like 0.000664
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013731   Gene: ENSMPUG00000013834   Transcript: ENSMPUT00000013948
Sequence length 735
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:6565926:6584787:1 gene:ENSMPUG00000013834 transcript:ENSMPUT00000013948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARALRLLTTLLAVAAASSRAEVESEAGWDMAAPDLLFAEGTAAYARGDWAGVVLSMER
ALRSRAALRALRLRCRTRCAADLPWELDPGLSPSPAQSSGANALQDLRFFGGLLRRAACL
RRCLGPPASHSLSEELELEFRKRSPYNYLQVAYFKINKLEKAVAAAHTFFVGNPEHMEMR
QNLDYYQTMSGVKEADFKDLESKPHMHEFRLGVRLYSEEQPHEAVAHLEAALREYLVADA
ECRALCEGPYDYDGYNYLEYNADLFQAIADHYIQVLSCKQNCVTELASHPSREKPFEDFL
PSHYNYLQFAYYNIGNYTQAIECAKTYLLFFPNDEVMNQNLAYYTAMLGEEAARSIGPRE
SAREYRQRSLLEKELLFYAYDVFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVRISQE
IGNLMKEIETLVEEKTKESLDVSRLTREGGPLLYEGISLTMNSKVLNGSQRVVMDGVISA
DECRELQRLTNAAATSGDGYRGQTSPHTPSEKFYGVTVFKALKLGQEGKVPLQSAHLYYN
VTEKVRRVMESYFRLDTPLYFSYSHLVCRTAIEEAQAERKDSSHPVHVDNCILNAEALVC
IKEPPAYTFRDYSAILYLNGDFDGGAFYFTELDAKTVTAEVQPQCGRAVGFSSGTENPHG
VKAVTRGQRCAIALWFTLDARHSERDRVQADDLVKMLFSPEEMDLSQEQPQEAQEGPPKP
ETPLSSSEVGHKDEL
Download sequence
Identical sequences M3YQX2
ENSMPUP00000013731 XP_004740681.1.14098 ENSMPUP00000013731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]