SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013733 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013733
Domain Number 1 Region: 360-658
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.09e-84
Family Pancreatic carboxypeptidases 0.00000000132
Further Details:      
 
Domain Number 2 Region: 786-1074
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.28e-68
Family Pancreatic carboxypeptidases 0.0000129
Further Details:      
 
Domain Number 3 Region: 1-245
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.31e-62
Family Pancreatic carboxypeptidases 0.0000014
Further Details:      
 
Domain Number 4 Region: 658-738
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.96e-19
Family Carboxypeptidase regulatory domain 0.0000333
Further Details:      
 
Domain Number 5 Region: 246-324
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.75e-16
Family Carboxypeptidase regulatory domain 0.00063
Further Details:      
 
Domain Number 6 Region: 1075-1172
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000373
Family Carboxypeptidase regulatory domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013733   Gene: ENSMPUG00000013836   Transcript: ENSMPUT00000013950
Sequence length 1241
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:2743216:2816353:-1 gene:ENSMPUG00000013836 transcript:ENSMPUT00000013950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGDETVSRQVLIYLARELAAGYRRGDPRIVSLLNTTDVYLLPSLNPDGFERSREGDCGL
SDSGPPGASGRDNSRGRDLNRSFPDQFSTGEPPNLDEVPEVRALMDWMRKNKFVLSGNLH
GGSVVASYPFDDSPEHKATGIYSKTSDDEVFKYLAKAYASNHPIMKTGAPRCPGEEDETF
KDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLRQEWENNRESLITLI
EKVHIGVKGFVKDSVTGSGLENATISVAGINHNITTGRFGDFHRLLVPGTYNITAVSTGY
MPLTINNIIVKEGPATKVNFSLRPTVASVIPDTTEVVVTASTVALLNNLPGTQSFHQPIQ
PKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVMEISDNPGVHEPGEPEF
KYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVRSTRIHLMPSMNPDGYEKAQEG
DSVSVIGRNNSNNFDLNRNFPDQFFQITDPTQPETIAVMSWMKSYPFVLSANLHGGSLVV
NYPFDDDEQGLATYSKSPDDAVFQQIALSYSKENSQMFQGRPCKNMYPNEYFPHGITNGA
SWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPFENDLPKFWEQNRRSLIQFMKQVHQGVK
GFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITASARGYNPVTQNVT
VKSEGATQVNFTLVRSSADSSNESKKGKGDRTNTDDVSDPTTREFETLIKDLSAENGLEV
LMLRSSSNLALYRYHSYKDLSEFLRGLVMNYPHITNLTNLGQSSEYRHIWSLEISNKPNI
SEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPAVTQLVDRTRIVIVPSLNPD
GRERAQEKDCTSKRGQTNAHGKDLDTDFTNNASQPETKAIIENLIQKQDFSLSVALDGGS
VLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPGCPNKSDENIPGGVMRGAEWH
SHLGSMKDYSVTYGHCPEITVYTSCCYFPSAAQLPSLWAENKKSLLSMLVEVHKGVHGFV
KDKTGKPISKAVIVLNEGIKVHTKEGGYFHVLLAPGVHNINAIADGYQQQHSQVFVHHDA
ASSVVIVFDTDNRIFGLPRELVVTVSGATMSALVLTACIIWCICSIKSNRHKDGFHRLRQ
HHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences M3YQX4
ENSMPUP00000013733 ENSMPUP00000013733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]