SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013748 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013748
Domain Number 1 Region: 66-397
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.83e-111
Family Rap/Ran-GAP 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013748   Gene: ENSMPUG00000013851   Transcript: ENSMPUT00000013965
Sequence length 993
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:7076287:7184892:-1 gene:ENSMPUG00000013851 transcript:ENSMPUT00000013965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSVSEDLGCRRGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDENATALPGTW
RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAIL
WRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVN
FKFGVLFAKDGQLTDDEMLSNEIGSDAFQKFLNLLGDKITLKGWTGYRGGLDTKNDTTGT
HSVYTVYHGHEIMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGEEPSPAFKPSMI
RSHFTHIFALVRYDQQNDNYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLING
EKATLETPTFAQKRRRTLDMLIRSLYQDLMPDLHKNMLNRRSFSDVLPESPKSARKKEEA
RQAEFVRIGQALKLKSIVRGDAPSSLVASGICKKEPWEPQCFCSDFPYEAVCADPWGQAL
LVSTDAGVLLVDDDLPSVPVFDKTLPVKQMHVLETLDLLILRADKGKDARLFVFRLSAVH
KAIESKQPVKSRCDCRDNKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKHNKPG
GLAGISLLSPLSESPVEEFQYIREICLSDSPAVMTLVDGPTEESDNLICVAYRHQFDVVN
ESTGEAFRLHHVEANRVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLVQPSA
SDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFT
ATTAVNEVSSGGSSKGASAHNSPQTPPGRDTPVFPSSLGEGETPSKNLYKIPLRNLVGRS
IERPLKSPLVSKAVTPPTAIGLGIAAIPVTHSLSLSRMEIKEIASRTRRELLGLSDEAGP
RSEGAPKPKSKARKQLEESQGGPKPGTARSTSSDRITTASLESPSAPEANPEGRYHSTGS
DQDPVADREGSPVWGSSPFQLTASSDEDIIDLK
Download sequence
Identical sequences M3YQY9
ENSMPUP00000013748 ENSMPUP00000013748 XP_004757335.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]