SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013754 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013754
Domain Number 1 Region: 14-304
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-80
Family Ras GEF 0.0000351
Further Details:      
 
Domain Number 2 Region: 454-578
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013754   Gene: ENSMPUG00000013857   Transcript: ENSMPUT00000013971
Sequence length 585
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:7226550:7462925:-1 gene:ENSMPUG00000013857 transcript:ENSMPUT00000013971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVSPEEFASQITL
MDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAE
ILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSK
EDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRII
ADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKE
DLAGPSAGSSSARFSRRPTCPDASVAGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSAT
FPSEKARHLLDDSVLESRSPRRALALTSSSAVTNGLSLGSSESSEFSEEMSSGLESRGRL
YATLGPNWRVPVRNSPRTRSCVYSPTGPCICTLGSSATVPTMEGPLRRKTLLKEGRRPAL
SSWTRYWVILSGSTLLYYGAKSLRGTDRKHYKSTPGKKVSVVGWMVQLPDDPEHPDIFQL
NNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQVPANLMSFE
Download sequence
Identical sequences M3YQZ5
ENSMPUP00000013754 XP_004757344.1.14098 XP_012914190.1.14098 ENSMPUP00000013754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]