SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013765 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013765
Domain Number 1 Region: 208-277
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-20
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 82-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000286
Family LIM domain 0.012
Further Details:      
 
Domain Number 3 Region: 52-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000127
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013765
Domain Number - Region: 143-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.035
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013765   Gene: ENSMPUG00000013868   Transcript: ENSMPUT00000013982
Sequence length 395
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:7661380:7743844:-1 gene:ENSMPUG00000013868 transcript:ENSMPUT00000013982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQ
RPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCME
KIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVS
PDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEV
SSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQEVLSS
RMEGMMASYTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTS
LSDCFLGSSDVGSLQARVGNPIDRLYSMQSSYFAS
Download sequence
Identical sequences A0A286ZUN2 A0A2J8NBW3 A0A2J8UKE9 A0A2K5S2P7 I2CX08 I3NEG6 M3YR06 O88609
ENSMPUP00000013765 ENSP00000436930 ENSP00000436930 NP_002307.2.87134 NP_002307.2.92137 XP_001097412.2.72884 XP_002820263.2.23681 XP_002916367.1.58354 XP_003407774.1.64505 XP_003785358.2.62490 XP_003940668.2.74449 XP_003995931.2.62641 XP_004269261.1.21590 XP_004671712.1.11716 XP_004757359.1.14098 XP_005321031.1.77405 XP_005346074.1.66349 XP_006834840.1.41390 XP_006988781.1.50099 XP_007471769.1.90284 XP_008004410.1.81039 XP_008153534.1.99482 XP_008823118.1.79516 XP_011709677.1.29376 XP_012003070.1.54773 XP_012313308.1.9421 XP_012495145.1.63892 XP_012495146.1.63892 XP_012627392.1.48125 XP_016817163.1.37143 XP_017404618.1.71028 XP_017911275.1.57651 XP_019276672.1.44245 XP_020957641.1.46622 XP_021049168.1.100879 ENSMPUP00000013765 gi|292494911|ref|NP_002307.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]