SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013778 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013778
Domain Number 1 Region: 1000-1128
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000025
Family GAF domain 0.012
Further Details:      
 
Domain Number 2 Region: 283-347,835-909
Classification Level Classification E-value
Superfamily EF-hand 0.000000674
Family Calbindin D9K 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013778   Gene: ENSMPUG00000013881   Transcript: ENSMPUT00000013995
Sequence length 1473
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:3070779:3216297:-1 gene:ENSMPUG00000013881 transcript:ENSMPUT00000013995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESASQEEHKPAQENGKEDKEGLEEATEVKEPTESSQSEPGSSALDTKSNVAEAAAEEK
SQGMHLEEQTETSVCSIKASKNLVVRKPAKVIFNLDPASLNSKLEQPWKKKCLERLEAKA
RAMQQKIIDKDNLKKEQEKKAGKNLPRDNLAKEWFNADNTTLNTRAYLLDKLLPILVPGV
EKMLMQVEKKQLWTEVDNTTRFNPINHLGEYLMRNNPYYIKDSGMSGYQRMMRDVTEDLK
IHVPDTTGNRISKMKEKIKQKQEQRQCITEVKVQVANTRKQALQEQFSEWIVDPEGMIPL
AVIQNVLHEFFQNPDFHLEACCQKLDIADSMEPRLNKMEFIEYLSSHIADFKSEMFEKLL
KHLCHCADEFREVIKMDMRRQMFAQLFLDCDHGKVGFLDRQRTLVLLETFYDQSSKTLRS
LLRNPRQWPLIEFEEIDLSEFWGDMDNQKHIYEDFDKVLLEMNALLSEKHASKTQRNSFE
TPEDQQKQDEHSESTLPEQQRRMTAEQEPSRISTEGQEQDGESSREKKLYRKSVTEQETH
TGSTPEQGSSRDLIIEQKPHGDSVIEQGPPERVSEQGVNMESATERGLHRASVSAQGQDE
GSTSERGSHRESVAGQGSHKGSTAEQEPPRGGIPEKQQGSALQPESITFRESNISRETTS
YEHTDISPQKERTQEKIYEGLFVNPEQQEEVPTSRRRYRLSETTKKENEKDPSCHKSQEI
EGKSWSGELSTCNWKMNNIKCEDEEQAHLLLSDSRFTDLHSIIRNIQSYKDIKGRSAFNG
VSLNLLQFVQLLETFVGEDTPLSVSETLTSFFKRGYVETKEEKISGLEQARQNASRARRE
LLLEAVFQKWDNDGSGFLDLKEVDEVLYTYKEGMEKESMKKAKLHIQFPKPHPNQEVRLS
LKQFQKYIELVVSELRGNEDHVLESVVEFLMNTLERSHIENLRNCARRKWLYQIQRAAET
SGVSLEPVYTETFNALTQDAEAHGSKKISAHISLLEENLLLPDRGQVLLRNVACTLDDAP
FVLNRVLYRDMEGISFTVVDEGKPIHVPQVQHHGNIFFWNTSVKKSDQNGSFLALPLQDA
HMRIFGVMAIDTLKDPQKINIFVPHEIRFYQGVANVFSTAYHYVHSREHILHVVITGIGW
LCDITSDITTITTYFIEPGPTQDSDYVLRNMMVTGHLGLTEIHRNPPTIFRKTCIFRDFL
FKCTDSSEVVLASVCGENHIIIPLRERTGKALGVLDFNIGRSKMLLYREFKDLQKMMKVV
QAACYEILGELSGEAKKNYVLEIENVGEVPRAGVLFFRIMLQELQESLRLLTSLDFVSLL
LYDYNLPPESSSLSESKAQEVGAGVKLVHDLLTAVILFIHPELESSGDFRDWEKCKRYVK
SYLVVNICDFDPTAKNVKVNLQLISEHIRDHSRIEVWEFGNTVIEYFYHWTHICLALMEL
NKKPSSTLVPPLPSKTDSCVYAKMPKGNVPGKC
Download sequence
Identical sequences M3YR19
ENSMPUP00000013778 XP_012908957.1.14098 XP_012908958.1.14098 ENSMPUP00000013778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]