SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013780 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013780
Domain Number 1 Region: 234-268
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000598
Family Myb/SANT domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013780
Domain Number - Region: 317-360
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00214
Family Erythroid transcription factor GATA-1 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013780   Gene: ENSMPUG00000013883   Transcript: ENSMPUT00000013997
Sequence length 622
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:2861868:2867891:1 gene:ENSMPUG00000013883 transcript:ENSMPUT00000013997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSR
QFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCK
YQAEIPDRLAEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSS
IRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASE
AMLFEEALEKYGKDFNDIRQDFVSETTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQ
IISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKT
PTQLEGAARGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLAR
RMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVA
QAPLKPKTPRGTKTPINRNQLTQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSG
SQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPPLIAVR
PPVPLSAPSHPASTNEPIVLED
Download sequence
Identical sequences M3YR21
ENSMPUP00000013780 ENSMPUP00000013780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]