SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013789 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013789
Domain Number 1 Region: 54-299
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.97e-41
Family WD40-repeat 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013789
Domain Number - Region: 426-468
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0109
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013789   Gene: ENSMPUG00000013893   Transcript: ENSMPUT00000014007
Sequence length 471
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:3485393:3492411:1 gene:ENSMPUG00000013893 transcript:ENSMPUT00000014007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRVVRQSKFRHVFGQAAKADQSYEDIRVSKVTWDSSFCAVNPKFLAIIVEAGGGGAFI
VLPLAKTGRVDKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTVMVWQVPDYTPVRNI
TEPIITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDMHPDVIHS
VCWNSNGSLLATTCKDKTLRIIDPRKGQVVAERFAAHEGMRPMRAVFTRQGHIFTTGFTR
MSQRELGLWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEP
PFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQD
DLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPR
RSQSASDAPLSQHTLETLLDEIKALREQVQAQEQRITALENMLCELVDGTD
Download sequence
Identical sequences M3YR30
ENSMPUP00000013789 XP_004746991.1.14098 ENSMPUP00000013789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]