SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013797 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013797
Domain Number 1 Region: 9-131
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-20
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013797   Gene: ENSMPUG00000013900   Transcript: ENSMPUT00000014015
Sequence length 139
Comment pep:known scaffold:MusPutFur1.0:GL897284.1:81277:82227:1 gene:ENSMPUG00000013900 transcript:ENSMPUT00000014015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLRGLESQPENLEQPFLSVFKKGRRRVPVRDLGKVVHYAKVQLRFQHSQDVSDCYLELFH
SYLYFQARGSKGLAFQGLLPLMELSVCPLEGSREHAFQITGPLPAPLHVLCPSQAELGHW
LYHLEKQIALVRGPQLCHS
Download sequence
Identical sequences G9KH96
ENSMPUP00000013797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]