SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013806 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013806
Domain Number 1 Region: 274-449
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.22e-17
Family RNA methyltransferase FtsJ 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013806
Domain Number - Region: 626-720
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.000791
Family ATP-dependent DNA ligase catalytic domain 0.062
Further Details:      
 
Domain Number - Region: 754-785
Classification Level Classification E-value
Superfamily WW domain 0.0111
Family WW domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013806   Gene: ENSMPUG00000013910   Transcript: ENSMPUT00000014025
Sequence length 835
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:10581942:10626606:-1 gene:ENSMPUG00000013910 transcript:ENSMPUT00000014025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRRNDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVNHAAKASTTSLSGSDSETEGK
QHSSDSFDDAFKADSLVEGTSSRYSMYNSVSQKLMAKMGFREGEGLGKYSQGRKDIVEAS
NQKGRRGLGLTLQGFDQELNVDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKR
KMIIEDETEFCGEELLHSVLQCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKM
ANMDFVFDRMFTNPRDSCGKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGM
TLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENITAFRNFVLDNTDRKGVHF
LMADGGFSVEGQENLQEILSKQLLLCQFLMALSVVRTGGHFICKTFDLFTPFSVGLIYLL
YCCFERVCLFKPITSRPANSERYVVCKGLKVGIDDVRDYLFSVNIKLNQLQNTDSDVNLV
VPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWG
IPDQARVAPSSSDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVLDYRCMVSGSEQ
KFLIGLGKSQIYTWDGRQSDRWVKLDLKTELPRDTLLSVEIVHELKGEGKAQRKISAIHI
LDVLVLNGSDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEMEKIFVRLE
MKIIKGSSGTPKLSYTGRDDRHFVPTGLYIVRTVNEPWTMGFSKSFKRKFFYNKKTKIST
FDLPADSIAPFHICYYGRLFWEWGDGIRVHDSQKPQDPDKLSKEDVLSFIQTHSA
Download sequence
Identical sequences M3YR47
ENSMPUP00000013806 XP_004740067.1.14098 XP_004740068.1.14098 ENSMPUP00000013806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]