SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013811 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013811
Domain Number 1 Region: 100-149
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000628
Family Hairy Orange domain 0.0028
Further Details:      
 
Domain Number 2 Region: 26-95
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013811   Gene: ENSMPUG00000013915   Transcript: ENSMPUT00000014030
Sequence length 225
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897284.1:106747:107722:-1 gene:ENSMPUG00000013915 transcript:ENSMPUT00000014030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADTPGKPRASPLAGAPARAHRTPNEPRSAAEHRKSSKPVMEKRRRARINESLAQLKSL
ILDAFRKDSSRHSKLEKADILEMTVRHLRSLRRVQAAAALSADPAVLGKYRAGFNECLAE
VNRFLAGCDGVPADVRSRLLGHLAACLGQLGPSRRPAPPPPSAEARAPEVFPGCPQLPAF
DRPFPLLRPGSAFALRLPPGLTGAPRNAPRAGLQNRGAPWRPWLR
Download sequence
Identical sequences M3YR52
ENSMPUP00000013811 ENSMPUP00000013811 XP_004781338.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]