SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013839 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013839
Domain Number 1 Region: 588-731
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 5.23e-52
Family gamma-adaptin C-terminal appendage domain-like 0.00000013
Further Details:      
 
Domain Number 2 Region: 8-155
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.21e-48
Family VHS domain 0.000000111
Further Details:      
 
Domain Number 3 Region: 172-300
Classification Level Classification E-value
Superfamily GAT-like domain 1.55e-36
Family GAT domain 0.00000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013839   Gene: ENSMPUG00000013944   Transcript: ENSMPUT00000014059
Sequence length 731
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:5817289:5831290:1 gene:ENSMPUG00000013944 transcript:ENSMPUT00000014059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEW
EAVQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGERVSEKVKTKVIELLYS
WTLALPEETKIKDAYHMLKRQGIVQSDPAIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAK
LLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVKLLNEMLLHYSKEDS
SEADKELMKELFDRCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTVVEGQ
VINGEITSSAMPDTEGNHSRSQGTLIDLAELATPSSSSSTPAPAPAPPASGIPILPPPPQ
TSGPGRSHSSGQAEATAGPNRASSALCLLDEELLCLGLADPAPTAPPKESAANSQWSLFP
NEQPDLDFCSPKPGSASCSPSDGPLVPASAPSAGSSQAPLPPPFPAPVVPASVPAPRAGS
FLLPTGLAPAPAPKAESTALGYHGSALGDSSLHQLDALDHLLEETRATSGLVKPLSSIFF
PGASASPLIPASTTARPLLPFSPGPGSPLFQPPAFQSQGSPMKGPELSLASVHVPLESIK
PSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPIKSIVLQAAVPKSM
KVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKARLRYRLTFALGEQLSTEVGEVD
QFPPVEQWGNL
Download sequence
Identical sequences M3YR80
ENSMPUP00000013839 ENSMPUP00000013839 XP_004748995.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]