SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013868 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013868
Domain Number 1 Region: 2-16,134-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-60
Family Nuclear receptor ligand-binding domain 0.000000142
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013868
Domain Number - Region: 52-59
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0112
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013868   Gene: ENSMPUG00000013973   Transcript: ENSMPUT00000014088
Sequence length 384
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:9512280:9533388:1 gene:ENSMPUG00000013973 transcript:ENSMPUT00000014088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKLETGPPMGVPPPPPPPPD
YMLPPSLHAPEPKGLASGPPAGPLGDFGAPALPMAMPGAHGPLAGYLYPTFPGRAIKSEY
PEPYASPPQPGPPYGYPEPFSGGPGVPELILQLLQLEPEEDQVRARIVGCLQEPAKGRPD
QPAPFSLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQIQH
GKEGSILLVTGQEVELSTVAAQAGSLLHSLVLRAQELVLQLHALQLDRQEFVCLKFLILF
SLDVKFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYL
YHKHLGNEMPRNNLLIEMLQAKQT
Download sequence
Identical sequences M3YRA9
ENSMPUP00000013868 ENSMPUP00000013868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]