SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013879 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013879
Domain Number 1 Region: 17-95
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000394
Family PDZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013879   Gene: ENSMPUG00000013984   Transcript: ENSMPUT00000014099
Sequence length 4377
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:2916362:2935547:1 gene:ENSMPUG00000013984 transcript:ENSMPUT00000014099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKEEDTTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVMRNSPAARTGVVKEGDQIVGAT
IYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTHEVFSSQSSEVVLSGDDE
DYQRIYTTKIKPRLRSEDGLEGEPGETQSRTITVTRRVTAYTVDVTGHEGAREIDISSPE
FKIKIPRHKLTEISAVDVETQPGKTVIRLPSGSGAASPTTGSVVDIRAGSVSASGPELQG
AGHSKLQVTVPGIKVGSPGVSVSAKSLDLGGKGGVQVPGADISSSLGGGAVEVQDPSLES
GTNGKIKIPTMKVPKFGVLTVPEGQAPGAGLSISAPEFSVGHKGGKPGLTIGGNIQTPQL
EVSAPSANIEGLEGKLKGPQITGPSLESDLGLKGAKPQGSIGVDISGPQIKGTVTGSSVE
VQAPDVDLHGPGGKLNMPKMKVPKFSVSGSKGEGTGIDVTLPTGEVTLPGISGDVSLPEV
AAGGLEGKVKGTKVKTPEMIMQKPKISMQDVDLSLGSPKVKGDIKVSVPGVQGDIKGPQV
AVKGSKVDTETPSLEGTLTGPTLGSPGKAGTCRISMADVDLNVAAPKMKGGVDVTLPKVE
GKVKVPEVDVKGPKVDVSAPGVEVHGPDWNLKMPKFSTPGAEGEGPDVDVKLPKGGVSIP
GPKVSVEAPNVNIAGPGGKLKGPDIKLPEMSVKTPKISIPDVDLHVKGTKVKGEYDVTVP
KLEGELKGPKMDTDAPDVDVQGPDWHLKMPKMKMPKFSVPGFKAEGPEVDVNLPKVDVDI
SGHKVDVSAPDVSLEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHLKGPKVKGEYDVTV
PKVEGEIKVPDVELKSAKVDINVPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVN
LPKADIDISGPTVDVEVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHMKGPKV
KGEYDVTVPKMEGELKGPKVDIGAPDVEVHGPEWNLKMPKMKMPKFTMPSLKGEAPKVDI
SAPDLGLEGPEGKLKGPKFKMPEMHFKAPKMTLPDVDLDLKGPKVKGSLDMSAPKIEGEM
KVPDVDIKGPQVDLKAPDVEVQGADWSLKMPKMKMPKFSMPSLKGEGPDVDVNLPKADID
ISGPKVDIEAPDVSLEGPEGKLTGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDVDVS
VPKIEGEMKVPDVDIRGPKLDVNVPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGPDVDV
NLPKADIDISGPKVDIEAPDVNIEGPEGKLKGPKFKMPEMHFKAPKISMPDVNLNLKGPK
LKGDVDVSVPDVEGEIKVPDVDIKGPKVDISAPDVDVQGPDWHLKMPKVKMPKFSMPGFK
GEGPEVDVNLPKANIDVSGPKVDVEVPDVNIDGPDAKIKGPKFKMPEMNIKPQKISMPDV
GLHLKGPKIKGDYDVTIPKVEGEIKADVDIKSPKVDINAPDVGGHGPDWHLKMPKVKMPK
FSMPGFKGEGPEVDVNLPKADIDVSVPKVDIDAPDVNIEGPEGKLKGPKFKMPSMNIQTH
KISMPDVGLNLKAPKLKTDVDVSLPKVEGDLKGPEIDMKTPKMDVDVGDVDIEGPEGKLK
GPKFKMPDMHFKTPKISMPDVDLHLKGPKVKGDVDVSMPKIEGEMKVPDVDIKGPKVDID
VPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADINVSGPKMDIDAPDLDI
EGPEGKLKGSKFKMPKLNIKAPKISMPDVDLNLKGPKVKGEIDASVPELEGELRGPQVDI
KGPSVDVEMPDVDLECPDAKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDVDVSV
PKIEGEMKVPDVDIKGPKLDVNVPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGPDVDVN
LPKADIDISGPKVDIEAPDVNIEGPEGKLKGPKFKMPEMHFKAPKISMPDVNLNLKGPKL
KGDVDVSVSKLEGDLKGPSVDVEMPDVELECPDAKLKGSKFKMPDMHFKTPKISMPDVDL
HLKGPKVKGDVDVSVPKIEGEMKVPDVDIKGPKVDIDAPDVDVHGPEWHLKMPKMKMPKF
SMPGFKGEGPDVDVNLPKADIDISGPKVDIEAPDMNIEGPEGKLKGPKFKMPEMHFHAPK
ISMPDVDFNLKGPKIKGDFDVSAPKLEGELKGPEVDVKGPKLDVDMPEVAVEGPDGKWKS
PKFKMPDMHFKAPKISMPDIDLHLKSPKIKGEVDVDVPKLEGDLKGPDLKGDISGPDIDI
EGPEGKLKGPKFKMPDMHFKAPNISMPDVDLNLKGPKIKGDVDVSVPEVEGKIKVPDVNI
KGPKVDINAPDVHGPDWHLKMPKMKMPKFSVPGFKAEGPEVDVNLPKADIGVSGPKVDIE
VPEMSIESPEGKIKGPKFKMPEMNIKAPKISMPDVDLHLKGPKVKGDVDISLPKVEGDLK
APKVDIDVPDVDVQGPDWHLKMPKMKMPKFSMPGFKGEGPEVDVNVPKADIDVTGPKVDT
EGPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDL
KGPEVNIKGPKVDVDVPDVDVQGPDWHLKMPKMKMPKFSMPGFKGEGPEVDVNXPDVNIE
GPDAKLKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGDVDVSLPNVEGDVKGPTLDIK
GPKIDVDAPDIDIHGPEGKLKGPKLKMPDMHVNMPKISMPEIDLNLKGAKLKGDVDVSGP
KLEGDVKAPKLDVKGPEVDISGPKVNLDGKAKKSRFKLPKFNFSGSKVQTPEVDVKVKKP
DIDVTGPKVDINAPDVEVQGKVKGSKFKMPFLSISSPKVSMPDVELNLKGPKVKGDLDVT
APNLEGDFKGPKVDIKAPEVHLDAPDVDVHGPDWSLKMPKMKMPKFGVPGLKVEGPEMAV
DLPKGDLNIEGPKVDIEGPEINVEGVEGSLKGPKLKMPDMNIKTPKISMPDIDLNLKGPK
VKGDMDVSLPKVEGDLKGPEIDIKGPKVDVDAPGVDVHGPDWHLKMPKVKMPKFSMPGFK
GEGPDVDVTLPKADIDISGPQMDIDAPDVNIEGPDVKLKGPKFKMPEMNIKAPKISMPDL
DLNLKGPKMKGDVDISLPKVEGDLKGPEVDIKGPKVDIDTPDINIEGPEGKLKGPKFKMP
EMHLKTPKISMPDIDLNLKGPKVKGDMDVSLPKFEGDLKGPEVDLKGPKVDIDAPDVDVH
GPDWHLKMPKIKMPKISMPGFKGEGPEVDVMKMPKVKMPKFSMPGFKGEGPEVDVNLPKA
DIDISGPKVDIDVPDVNIECPDAKLKGPKFKMPEINIKAPQISMPDVDLDLKGSKIKGDF
DVSVPKIEGTFKGPEVDLKGSGLGFEGPDAKLSGPHLKMPSLDISAPKVTVPDVDLHFKA
PKIGISGPKLEGAELDLKGPKVDLEAPSLDVHTESPDITVEGPDIKIPKFKKPKFGFGAK
SPKADIKSPSLDVTVPEAEMNVETPEISVGGKGKKSKFKMPKIHMSGPKMKAKKQGFDLN
VPGGEIDASLKVPEVDVNVTGPDATLKGDVKSPKTKKPMFGKMYFPDVEFDIKSPKFKAE
APLPSPKLEGEIQAPDVDISSPGIHVEGPDIKVKAPKFKLPGMDVSGKLEGDLKGPRVQA
NLDTPDINIEGPDAKVKAPSFSISGPQVSIPDVNVSLKGPKVKGDVPSVGLEGPDIDLQG
PESKIKFPKFSVPKIGVPGVKMEGGGAEVHAQLPSLEGGLSTPDVKLEGPDVSLKGPKVD
LPSVNLSMPKISGPDVDLNLKGPSLKGDLDASVPGVKVHAPGLDLRGQGGKVRMEGDGVK
VPGIDTTLNLGTPDVTLKGPSLQGDLAVSGDIKCPKVSVGAPDVSLEAPEGGIKLPKMKL
PQFGISTPGSDLDVNVQGPQVTGELQAPAMDVNLGGLSLKGPQISGPQVSAPDMDLNLEG
PKIKGSLGATGEMKGPTVGGSHLGVSVEGLGGNLQMPGIKSSGCDVELPGVNVKLPTGQI
SGPEIKGDLKGSGIGFHGAAPDISVKGPSLNVASPESDFGVSLKGPKIKGGVDVSGVVST
PAVSLGEGHVSVKGPQATSALNLDAPKFAGGLHFSGPKVEGGVKGDQVGLQGPGLSVSGS
PGHLESRSGKVTFPKMKIPKFTFSGRELIGREVGVDINFPKVEATAQAGAGEGEWEESDV
KLKKSKIKMPKFNFSKPKAKGGVTGSPEASISGSKGDLKSSKASLGSLEGDTEAETSSPK
GKFSLFKSKKPRHRSNSFSDERELSAPSTPTGTLEFEGGEVKGKHAKLKFGTFGGLGSKS
KGHYEVTGSDDEAGKLQGSGVSLASKKSRLSSSSSNDSGTKVGIQLPEVELVVSKKE
Download sequence
Identical sequences M3YRC0
ENSMPUP00000013879 ENSMPUP00000013879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]