SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013945 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013945
Domain Number 1 Region: 7-146
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.51e-38
Family Gelsolin-like 0.00000483
Further Details:      
 
Domain Number 2 Region: 377-515
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.38e-35
Family Gelsolin-like 0.00000882
Further Details:      
 
Domain Number 3 Region: 242-433
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.66e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.0081
Further Details:      
 
Domain Number 4 Region: 609-714
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.21e-32
Family Gelsolin-like 0.00000833
Further Details:      
 
Domain Number 5 Region: 128-237
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.96e-28
Family Gelsolin-like 0.0000154
Further Details:      
 
Domain Number 6 Region: 508-601
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.04e-20
Family Gelsolin-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013945   Gene: ENSMPUG00000014051   Transcript: ENSMPUT00000014166
Sequence length 715
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:25330437:25406766:-1 gene:ENSMPUG00000014051 transcript:ENSMPUT00000014166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQGLYHEEFARAGKQAGLQVWRVEKLELVPVPQSAYGDFYVGDAYLVLHTVKAGQGFTY
RLHFWLGKECTQDESTAAAIFTVQMDDYLSGKPVQSRELQGYESTDFVGYFKGGLKYKAG
GVASGLNHVLTNDLTAKRLLHVKGRRVVRATEVPLSWDSFNKGDCFIIDLGTEIYQWCGS
SCNKYERLKASQVAIGIRDNERKGRSQLIVVEEGSEPSELRKVLGTKPELPDGNDDDDTI
ADITNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGSAKQIFVWKGKD
ANPQERKAAMKTAEEFLKQMNYSSNTQIQVLPEGGETPIFKQFFKDWREKDQSDGFGKVY
VTEKVAQIKQIPFDASKLHTSPQMAAQHNMVDDGSGKVEIWRVENNGRVEIDQNSYGEFY
GGDCYIILYTYPRGQIIYTWQGADATRDELTTSAFLTVQLDRSLRGQAVQIRVSQGKEPA
HLLSLFKDKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIMEVDVDAQSLNSNDV
FVLKLRQNNGYIWIGKGASQEEERGAEYVASVLKCKTTKIQEGEEPEEFWNSLGGRKHYQ
TSPLLETQAEDHPPRLYGCSNKTGRFIIEEVPGEFTQDDLAEDDVMLLDAWEQIFIWIGK
DANEVERTESLKSAKMYLETDPSGRDKRTPIVIVKQGHEPPTFTGWFLGWDSRRW
Download sequence
Identical sequences M3YRI6
ENSMPUP00000013945 ENSMPUP00000013945 XP_004743481.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]