SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013956 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013956
Domain Number 1 Region: 31-83
Classification Level Classification E-value
Superfamily TNF receptor-like 4.07e-16
Family TNF receptor-like 0.00026
Further Details:      
 
Domain Number 2 Region: 84-142
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000118
Family TNF receptor-like 0.0000556
Further Details:      
 
Domain Number 3 Region: 144-167
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000942
Family TNF receptor-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013956   Gene: ENSMPUG00000014064   Transcript: ENSMPUT00000014179
Sequence length 270
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897284.1:282379:284995:-1 gene:ENSMPUG00000014064 transcript:ENSMPUT00000014179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRLLVQAWRPRGPPSALLLFGLVLGAAARLTCVGDAYPKDGRCCQDCPPGYGMERRCSGG
QDTECHPCRSGFYNEATNYEPCKPCTQCNQRSGSEPKQRCTPTQDTVCGCKPGTEPQDGF
KRGVDCAPCPPGHFSPGDDQACKPWTNCTLKGKRTVRPASQSSDAVCEDRSPPATLPWET
QGPPAWPPTTQPTTAWARASQEPFTPPAEPPRGPQLAAVLGLGLGLLAPVAAALALLLHH
RAWRLPPSGNSFRTPIQEEHSDANSALAKI
Download sequence
Identical sequences M3YRJ7
ENSMPUP00000013956 ENSMPUP00000013956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]