SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014001 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014001
Domain Number 1 Region: 8-219,327-385
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-52
Family FAD-linked reductases, N-terminal domain 0.0000621
Further Details:      
 
Domain Number 2 Region: 222-327
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.89e-24
Family D-aminoacid oxidase-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014001   Gene: ENSMPUG00000014109   Transcript: ENSMPUT00000014224
Sequence length 392
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:3983586:3998510:-1 gene:ENSMPUG00000014109 transcript:ENSMPUT00000014224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQKDLCDAIVIGAGIQGCFTAYHLARHGKRVILLEQFFLPHSRGSSHGQSRIIRRAYP
EDFYTQMMDECYQIWAQLEREAGTQLHRQTGLLLLGMKENSELKTIQATLSRQGVEHQCL
SAEELKQCFPNVRLARGEVGLLDKSGGVLYADRALRALQDAIQRLGGLVRDGEKVEEIKP
GQPITVRSTSRSYQARSLIITAGPWTNRLLRPLGIELPLRTLRINVCYWREKVPGSYGVS
QAFPCFLGLGLSQAPHHIYGLPSGEYPGLMKVCYHHGNNADPEERDCPEAFSETQDIHIL
SRFVRDHLPDLEPKPAIMERCLYTNTPDEHFVLDRHPKYDNIVIGAGFSGHGFKLSPVVG
KILYELSMKLTPSYDLTPFRMSRFPGLGKAHL
Download sequence
Identical sequences M3YRP1
ENSMPUP00000014001 XP_004747007.1.14098 ENSMPUP00000014001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]