SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014012 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014012
Domain Number 1 Region: 28-145
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-31
Family Ankyrin repeat 0.00088
Further Details:      
 
Domain Number 2 Region: 412-472
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000044
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014012   Gene: ENSMPUG00000014120   Transcript: ENSMPUT00000014235
Sequence length 483
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:6097263:6104283:1 gene:ENSMPUG00000014120 transcript:ENSMPUT00000014235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHLFSELNLGNREREQDKPGAMNDQYHRAARDGYLELLKEATRKELNAPDEDGMTPTLW
AAYHGNLESLRVIVSRGGDPDKCDIWGNTPLHLAASNGHLHCLSFLVSFGANIWCLDNDY
HTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKMQRKHH
ERMERRYRRELAERSDALSFSSLTSSTLSRRLQHLALGSQLPYSQATLHGTARGKAKIQR
KLERRKQGGEGTFKISEDGRKSVRSLSGLQLGSDVMFVRQGTYANPKEWGRAPLRDMFLS
DEDSVSRATLAAEPAHSEVSTDSGHDSLFTRPGLGTMVFRRNYLSSGLHGLGREDAAPDG
GGAPRGRLQSSPSLDDDSLGSANSLQDRSCGEELPWDELDLGLDEDLEPETSPLETFLAS
LHMEDFASLLRQEKIDLEALMLCSDLDLRSISVPLGPRKKILGAVRRRRQALERPPALED
TEL
Download sequence
Identical sequences M3YRQ2
XP_004749035.1.14098 XP_004749036.1.14098 ENSMPUP00000014012 ENSMPUP00000014012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]