SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014013 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014013
Domain Number 1 Region: 157-280
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.08e-23
Family Synaptotagmin-like (S variant) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014013   Gene: ENSMPUG00000014121   Transcript: ENSMPUT00000014236
Sequence length 308
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:8327453:8362066:1 gene:ENSMPUG00000014121 transcript:ENSMPUT00000014236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNGEPGPASAAASRNVVRSSSISGEICSSQQAGGGPGTTTAKKRRSSLGAKMVAIVGLT
QWSKSTLQLPQSEGATKKLRSTIRRSTETGIAVEMWSRVTRQGSRESTDGSTNSNSSEGT
FIFPTTRLGAESQFSDFLDGLGPAQIVGRQTLATPPMGDVHIAIIDRSGQLEVEVIEARG
LTPKPGSKSLPATYIKVYLLENGACLAKKKTKVAKKTCDPLYQQALLFDEGPQGKVLQVI
VWGDYGRMDHKCFMGMAQIMLDELDLTAAVTGWYKLFPTSSVADSTLGSLTRRLSQSSLE
SATSPSCS
Download sequence
Identical sequences M3YRQ3
ENSMPUP00000014013 ENSMPUP00000014013 XP_004740719.1.14098 XP_004740720.1.14098 XP_004740721.1.14098 XP_004740723.1.14098 XP_004740724.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]