SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014018 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014018
Domain Number 1 Region: 340-539
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.45e-16
Family DNA-binding domain from NDT80 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014018
Domain Number - Region: 185-195
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014018   Gene: ENSMPUG00000014126   Transcript: ENSMPUT00000014241
Sequence length 1150
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:3701188:3731171:-1 gene:ENSMPUG00000014126 transcript:ENSMPUT00000014241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVDETEALQRFFEGHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPAGAASYP
HGPPAIPGSSGGHHLSPPGGGPSPGRHGSLPAPSYSAPLNCNNNAMASAPKPFLGGSGPP
IKAEPKAPYAPGTLPDSPPDSGSEAYSPQQVNDSHLLRTITPETLCHVGVPPRLEHPPPP
PAHLPGPPPPPPPPPHYPVLPRDLYMKAEPPMPAYAAMGQGLVPSDLHHTQQSQMLHQLL
QQHGAELPAHPSKKRKHSESPSNTLNAQMLNGMIKQEPGTAATLPPHPARAPSPPWPPQG
PLSPGPGSLPLSIARVQTPPWHPPGVPSPGLLQDSDSLSGSYLDPNYQSIKWQPHQQNKW
ATLYDANYKELPMLTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGLLGEPKYVKTPE
GLKPLDCFYLKLHGVKLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLHF
SETTANNMRKKGKPNPDQRYFMLVVALQAHAQNQNYTLAAQISERIIVRASNPGQFESDS
DVLWQRAQVPDTVFHHGRVGINTDRPDEALVVHGNVKVMGSLMHPSDLRAKEHVQEVDTT
EQLKRISRMRLVHYRYKPEFAATAGIEATAPETGVIAQEVKEILPEAVKDTGDVVFANGK
TIENFLVVNKERIFMENVGAVKELCKLTDNLETRIDELERWSHRLARLRRLDSLKSTGSS
GAFSHAGSQFSRAGSVPHKKRPPKVASKPSSVVPDQACISQRFLQGTIIALVVVMAFSVV
SMSTLYVLSLRTEEDLVETDGSFAVSTSCLLALLRPQHPGGSEALCPWSSQSFGTTQLRQ
SPVTTGVPGTPPSLLLVTTGLTSSAPGPVIPTLDLCSSHPCPVVCCSSATPSPTAAPSLG
PSFKPGHGLRPSPSPSTNSSGPSQMALLPVTNIRAKSWSLSANGIGHSKHPKSSEPLASP
AVPFPGGQGKAKNSPSLGLHGRTRRGVPQPGLSPAQPTQAGGQPASLLADPLPSLTSIQV
LETSMPITSQYCAPGDACRPGNFTYRIPVSSSTPLHLSLTLQMNSSSPVSVALCSLMSKE
EPCEEGGFPQSLHTHQDTQGTSHQWPVTILSFREFTYHFRVALLGQANCSAEAPVRPATD
YYFHFYRLCD
Download sequence
Identical sequences M3YRQ8
ENSMPUP00000014018 ENSMPUP00000014018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]