SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014036 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014036
Domain Number 1 Region: 58-152
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.23e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014036   Gene: ENSMPUG00000014143   Transcript: ENSMPUT00000014259
Sequence length 456
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:8536301:8567091:-1 gene:ENSMPUG00000014143 transcript:ENSMPUT00000014259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKYLSVCYRTREETLHRIGSSSSHTLQTKWPRNDACREGLLNLSTVDILDASLLRGCPV
PGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLY
EAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSEPAPEKKM
EPVVFEKVKMPQKKEDPQLPRKSSPKSSAPVMDLLGLDAPVSCSMANSKTSNTLEKDLDL
LASVPSPSSSVSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEETGKKQLSKDSILSLYG
SQTPQLPAQAMFMAPAQMAYPTAYPSFPGVTPPSSIMGSMMPPPVGMVAQPGASGMVAPM
AVPAGYMGGMQASMMGVPNGMMTPQQAGYMAGMAAVPQTMYGVQPAQQLQWNLTQMTQQM
AGMNFCGAHGMLTYGQSMSGGNGQAANQTLSPQMWK
Download sequence
Identical sequences M3YRS6
ENSMPUP00000014036 ENSMPUP00000014036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]