SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014073 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014073
Domain Number 1 Region: 220-296
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.01e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014073   Gene: ENSMPUG00000014181   Transcript: ENSMPUT00000014297
Sequence length 337
Comment pep:known scaffold:MusPutFur1.0:GL897121.1:2533092:2536145:-1 gene:ENSMPUG00000014181 transcript:ENSMPUT00000014297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLALRPVRQEIRRLQRRPGSSDVPPYREMKGQQKTAEAEEGTVQIQEGAVATGEDPTSVA
IASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQ
AVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVVTTQGSEALLGQA
TPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERRRR
DKINNWIVQLSKIVPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQ
LDNDVLRQQVEDLKNKNLLLRAQLRHHGVEVVIKNDS
Download sequence
Identical sequences G9KWQ9
ENSMPUP00000014073 ENSMPUP00000014073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]