SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014074 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014074
Domain Number 1 Region: 178-311
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.33e-26
Family Synaptotagmin-like (S variant) 0.023
Further Details:      
 
Domain Number 2 Region: 21-135
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.46e-21
Family Synaptotagmin-like (S variant) 0.038
Further Details:      
 
Domain Number 3 Region: 343-523
Classification Level Classification E-value
Superfamily vWA-like 4.89e-17
Family Integrin A (or I) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014074   Gene: ENSMPUG00000014182   Transcript: ENSMPUT00000014298
Sequence length 610
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:11182907:11271971:1 gene:ENSMPUG00000014182 transcript:ENSMPUT00000014298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQWR
EFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLG
EIVGSPGSRLEKPLTIGAFSLNSRTGKPMPAVSNGSGLWMENLRTTGLEASGGVPGKKCG
TIILSAEELSNCRDVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKN
TLNPVWQTFSIPVRALCNGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELARGQSQFNI
YEVVNPKKKMKKKKYVNSGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGNPS
QSTSLHYMSPYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGN
QENPSCCGIDGILEAYHHSLRTVQLYGPTNFAPVVTHVARTAAAVQDGSQYSVLLIITDG
VISDMAQTKEAIVNAAKLPMSIIIIGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFV
PFRDYVDRTGNHVLSMARLARDVLAEIPDQLVSYMKAQGIRPRPPPAAPESSPPRSPAHT
PPASPLHTHI
Download sequence
Identical sequences M3YRW4
ENSMPUP00000014074 ENSMPUP00000014074 XP_012918397.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]