SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014075 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014075
Domain Number 1 Region: 10-95
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-27
Family PDZ domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 147-242
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-27
Family PDZ domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014075   Gene: ENSMPUG00000014183   Transcript: ENSMPUT00000014299
Sequence length 366
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:6230647:6247548:-1 gene:ENSMPUG00000014183 transcript:ENSMPUT00000014299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQFIRLVEPGSPAEKAGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDERLQKLGVQVREELLHAQDGPGQA
EPPAATEAQEAGGENEPQAAAPEPRETDKSRPERRELRPRLCTMKKGANGYGFNLHSDKS
RPGQFIRAVDPDSPAEASGLRAQDRIVEVNGVCVEGKQHGDVVSAIKAGGDETKLLVVDK
ETDEFFKKCRVIPSQEHLSGPLPEPFTNGEIQKENSREALTEVASDSPRSALARSTSSDT
SEELNSQDSPRKQDSTARSSTSSSSDPILDFSVSLAVAKERAHQKRSSKRAPQMDWSKKN
ELFGNL
Download sequence
Identical sequences M3YRW5
XP_004749055.1.14098 ENSMPUP00000014075 ENSMPUP00000014075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]