SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014085 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014085
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily PDZ domain-like 7.62e-16
Family PDZ domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014085
Domain Number - Region: 575-659
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.012
Family FCH domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014085   Gene: ENSMPUG00000014194   Transcript: ENSMPUT00000014310
Sequence length 1535
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896945.1:11942432:12154882:-1 gene:ENSMPUG00000014194 transcript:ENSMPUT00000014310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENRPGSFQYVPVQLQGGAPWGFTLKGGLEHCEPLTVSKIEDGGKAALSQKMRTGDELVN
INGTPLYGSRQEALILIKGSFRILKLIVRRRNTPVFRPHSWHVAKLLEGCPEAATTMHFP
SEAFSLSWHSGCNTSDVCVQWCPLSRHCSTEKSSSIGSMESLEQPGQVTYEGHLLPIDQN
MYPNQRDSAYSSFSASSNASDCALSLRPEEPGSADCLTQGPGPTKAPNGRPSVAETSGGS
RRTTGGPLTPSSQLSSRLQEAHHSGPAKAARGPPQPPVRRDSLQASRAQLLNGEQRRASE
PGDSSQQKEKVSLDTMLSPRNPSRFCCLSGQDQVANEGQQNCELSQVSESSQQDSEHLLM
EASAKAVGFPKVYDKASSIDSSQLNEASAEQAKTSSFGSPPHLTGLTGHRHSAPEQLLAS
HLQHVHLDARGSKGTEFPAGQDGHEWTLSPLHSSHTGKISPCPPPGGAQDQPSKERKARQ
LDDRPLGSGHQSPSSSPHREADGHPPEKGFQDPNRACRAGIDLASQQPSASGSLVQQARD
CSSTTKGAGSTEATEEGECGRVGGRRNGGPRGRSIQNRRKSERFATNLRNEIQRRKAQLQ
KSKNTLSQLCDTKESVEETEEPLESTPLPASNSSLLSSCKKPPSPRDKLFNKSMILRAQS
SECLSQAPESHESTGLEGQISPAQRPGQPSVGLNTWWKASEPSLSDSEKTSVRRRVRGGH
WRWSPEHNLQPHVALAMEGPPNPGDSKELKASATQAGEEAILLPFADRRKFFEESSKSFS
ASHLPGLTTHSSKTFAQRPKPIDQNFQPMSSSYRELRRHPMDQSYHSADQPYRAPEQSYH
SLSPLQSETPTYSECFASKGLEQSMCCKPLHCSDFEYRRTCSYSCGIQGAVVHDPCIYCP
GELCPALWKRNMMPNCYSCRCHHHQCIRCAACYHNPQHGGPEDSSLAPGTTWKPRKPTVQ
EFPGDKWKPITGNRKTSQLGREMAHSKASLSWATPFHPCLENPALDLSSYRAISSLDLLG
DFKHSSKETEETSAYEEGSSMASMPRPLRSRAFSESHISLEPQSSGAWGQHRRELFTKVD
ETQRDPLGARKKAFPPPRPPPPNWEKYRLFRATQQQQQQKQQQEEEEEEEEEGEEEEEEE
GGEEEGEEEELPPQYFSSETTGSTALHPEEVLEQPQPLGFGHLEASKQSSQNHPTEQESS
GLHPSDFLPPVRGHLGSQPEKTQPPCCYSTGGLWRTSEKEIANSPKPEASMAEESKPKPA
WSQSYFFPEEQFSFVGWGSEKQHLSPTGFSEPKTTGQESQHFSPPLGAPGMPTSYSAYYN
ISVAKAELLNKLKDQPEMAEIGLEEEEVDHELAQKKIQLIESISRKLSVLREAQRGLLED
ISANSALGEEVEANLKAVCKSNEFEKYRLFIGDLDKVVNLLLSLSGRLARVENALNSIDS
EANQEKLVLIEKKQQLTGQLADAKELKEHVDSREKLVFGMVSRYLPQDQLQDYQHFVKMK
SALIIEQRELEEKIKLGEEQLKCLRESLLLGPSNF
Download sequence
Identical sequences M3YRX5
ENSMPUP00000014085 ENSMPUP00000014085 XP_012913007.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]