SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014114 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014114
Domain Number 1 Region: 2-240,269-294
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-88
Family BAR domain 0.00044
Further Details:      
 
Domain Number 2 Region: 407-523
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.67e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.00021
Further Details:      
 
Domain Number 3 Region: 266-370
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-28
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 675-791
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.08e-24
Family Ankyrin repeat 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014114   Gene: ENSMPUG00000014222   Transcript: ENSMPUT00000014339
Sequence length 837
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897284.1:343120:360137:-1 gene:ENSMPUG00000014222 transcript:ENSMPUT00000014339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEFEECIKDSPRFRATIDEVETDVVEMEGKLDKLVKLCSGMIEAGKAYVTTNRLFLSG
VRDLSQQCQGDAVISECLQRFGDSLQEMVNYHMILFDQAQRSVRQQLHNFVKEDVRKFKE
TKKQFDKVREDMELSLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQA
KKKFEILDSMLSFMHAQYSFFQQGYSLLHQLDPYMKKLAAELDQLVIDSAVEKRDMERKH
AAIQQRXATVSAGDFSYDEPKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQ
LVYQKKVKDALTVVVDDLRLCSVKPCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWVRA
VQASIASAYRESPDSCYSERLDRTASPSTSSIDSATDSRERGVKGESLLQRVQNVAGNGQ
CGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNS
TVNQIYEAQCEGPGSRKPTASSSRQDKEAWIKDKYVEKKFLRKVPSAPAREAPRPWRVQK
CHRHHSSPRAPAARRKVRLEPVLPSVAALSSASGAVERKFRRDSLFCPDELDSLFSYFDA
GAAAAGPRSLSSDSGLGGSSDGSSDVLAFGAGSVVDSVTEEEGAESEESSGEADGEAEAW
GLADVRELHPGLLAHRAARTRDLPALATALAHGAEVNWADAEDEGKTPLVQAVLGGSLIV
CEFLLQNGADVNQRDSRGRAPLHHATLLGRTGQVCLFLKRGADQHALDHEQQDPLSIAIQ
EANADIVTLLRLARMAEEMREAEAPPGQPGPLAGSSPTELQYRRCIQEFISLHLEES
Download sequence
Identical sequences M3YS04
ENSMPUP00000014114 ENSMPUP00000014114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]