SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014130 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014130
Domain Number 1 Region: 50-375
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.7e-73
Family Pancreatic carboxypeptidases 0.000000984
Further Details:      
 
Domain Number 2 Region: 375-471
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.53e-22
Family Carboxypeptidase regulatory domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014130   Gene: ENSMPUG00000014238   Transcript: ENSMPUT00000014355
Sequence length 476
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897205.1:1014617:1127024:-1 gene:ENSMPUG00000014238 transcript:ENSMPUT00000014355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQGGRALLALCGALVACGWLLGAGAQDPGAPAAGMRRRRRLQQEDGISFEYHRYPELR
EALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVG
RELLIFLAQYLCNEYQKGNETIVKLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRS
NAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNLKKIVDQNTKLAPETKAVIHWIMDIP
FVLSANLHGGDLVANYPYDETRTGSAHEYSSCPDDAIFQSLARAYSSFNPPMSDPNRPPC
RKNDDDSSFIDGTTNGAAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEDTLKSYWED
NKNSLVSYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLVPGNYK
LTASAPGYLAITKKVAVPYSPAVGVDFELESFSQRKEEEKEELMEWWKMMSETLNF
Download sequence
Identical sequences M3YS20
ENSMPUP00000014130 ENSMPUP00000014130 XP_004779598.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]